HBsAg, Pre-S1 & Pre-S2 peptide


print

Pre-S1 peptide produced in E.coli. There are two types of products, one is tagged peptide and the other is no tagged peptide. In general, the former product is good for immunoassay use, and the latter for standard use.

Background

The surface antigen of Hepatitis B virus (HBV) is composed of Pre-S1, Pre-S2, and S domains. The longest surface antigen, which has all the three domains, is called L protein, the middle sized antigen which has Pre-S2 and S domains, is called M protein, and the smallest one conissted of S domain is called S protein. S protein is generally also called HBsAg. Pre-S1domian is known to be the target molecule of HBV recptors expressed on human hepatic cell surface. On the other hand, Pre-S2 domain is reportedly related to HBV invasion into cells and carcinogenesis. Thus, Pre-S1 and Pre-S2 domains are becoming more and more important in HBV research field.
The products are recombinant peptides having Pre-S2 domian. Two types of peptides are available; one has no tag peptide, and the other is fusion peptide with a tag-peptide. Chose eihter one suitable for your research purpose.

Amino acid sequence

BCL-AGS1-01 (no Tagj:
AMADIGSMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGVL TTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA (115aa)


BCL-AGS1-21 (Taggedj
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL FKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAD IGSMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNPNKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGVLTTVP VAPPPASTNRQSGRQPTPISPPLRDSHPQA (273aa, underline:Thioredoxin-His Tag)

 

BCL-AGS2-01(no tag):
AMADIGSMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISGDPAPN (56aa)


BCL-AGS2-21(tagged):
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL FKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAD IGSMQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISGDPAPN (214aa, underline Thioredoxin-His Tag)

Note: Pre-S2 peptides lack some amino acids (from 44 to 49), but it is well recognized by general anti-Pre-S2 antibodies.

SDS-PAGE Example Data

Silver Stain

Coomassie stain


 

Product List

Product Name Cat# Quantity Price

HBsAg, Pre-S1 peptide DataSheet ,

BEC-BCL-AGS1-01

100 UG see also
# BEC-BCLAGS102
Size 100

HBsAg, Pre-S1 peptide Thioredoxin-His Tag DataSheet ,

BEC-BCL-AGS1-21

100 UG ¥60,000
$800

HBsAg, Pre-S2 peptide DataSheet ,

BEC-BCL-AGS2-01

100 UG ¥80,000
$1067

HBsAg, Pre-S2 peptide Thioredoxin-His Tag DataSheet ,

BEC-BCL-AGS2-21

100 UG ¥60,000
$800

To be used for research only. DO NOT use for human gene therapy or clinical diagnosis.


“HBsAg, Pre-S1 & Pre-S2 peptide” also belongs to the following categories.